Lineage for d2hv6a1 (2hv6 A:22-322)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.268: PTPA-like [140983] (1 superfamily)
multihelicalSuperfamily a.268.1: PTPA-like [140984] (1 family) 
automatically mapped to Pfam PF03095Family a.268.1.1: PTPA-like [140985] (2 proteins)
Pfam PF03095Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species) Species Human (Homo sapiens) [TaxId:9606] [140987] (4 PDB entries)
Uniprot Q15257 22-322! Uniprot Q15257 23-322
Domain d2hv6a1: 2hv6 A:22-322 [136784]
complexed with mg
Details for d2hv6a1
PDB Entry: 2hv6 (more details), 1.9 Å
PDB Description: Crystal structure of the phosphotyrosyl phosphatase activator
PDB Compounds: (A:) Protein phosphatase 2A, regulatory subunit BSCOPe Domain Sequences for d2hv6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hv6a1 a.268.1.1 (A:22-322) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
s
SCOPe Domain Coordinates for d2hv6a1:
Click to download the PDB-style file with coordinates for d2hv6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hv6a1:
- d2hv6a1 first appeared in SCOP 1.73
- d2hv6a1 appears in SCOPe 2.07
View in 3D
