Lineage for d2hv6b_ (2hv6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016427Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 2016428Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 2016429Family a.268.1.1: PTPA-like [140985] (2 protein domains)
    Pfam PF03095
  6. 2016430Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 2016435Species Human (Homo sapiens) [TaxId:9606] [140987] (4 PDB entries)
    Uniprot Q15257 22-322! Uniprot Q15257 23-322
  8. 2016439Domain d2hv6b_: 2hv6 B: [136785]
    automated match to d2hv6a1
    complexed with mg

Details for d2hv6b_

PDB Entry: 2hv6 (more details), 1.9 Å

PDB Description: Crystal structure of the phosphotyrosyl phosphatase activator
PDB Compounds: (B:) Protein phosphatase 2A, regulatory subunit B

SCOPe Domain Sequences for d2hv6b_:

Sequence, based on SEQRES records: (download)

>d2hv6b_ a.268.1.1 (B:) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
s

Sequence, based on observed residues (ATOM records): (download)

>d2hv6b_ a.268.1.1 (B:) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epaglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfitemktgp
faehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvts

SCOPe Domain Coordinates for d2hv6b_:

Click to download the PDB-style file with coordinates for d2hv6b_.
(The format of our PDB-style files is described here.)

Timeline for d2hv6b_: