Lineage for d2hv7h1 (2hv7 H:22-322)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651933Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 651934Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
  5. 651935Family a.268.1.1: PTPA-like [140985] (1 protein)
    Pfam PF03095
  6. 651936Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 651946Species Human (Homo sapiens) [TaxId:9606] [140987] (4 PDB entries)
  8. 651958Domain d2hv7h1: 2hv7 H:22-322 [136793]
    automatically matched to 2HV6 A:22-322
    complexed with adp

Details for d2hv7h1

PDB Entry: 2hv7 (more details), 2.5 Å

PDB Description: Crystal structure of phosphotyrosyl phosphatase activator bound to ATPgammaS
PDB Compounds: (H:) Protein phosphatase 2A, regulatory subunit B

SCOP Domain Sequences for d2hv7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv7h1 a.268.1.1 (H:22-322) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
s

SCOP Domain Coordinates for d2hv7h1:

Click to download the PDB-style file with coordinates for d2hv7h1.
(The format of our PDB-style files is described here.)

Timeline for d2hv7h1: