Lineage for d2hrya1 (2hry A:2-166)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960238Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2960239Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2960275Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 2960276Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
    TM1246
  8. 2960285Domain d2hrya1: 2hry A:2-166 [136704]
    Other proteins in same PDB: d2hrya3, d2hrya4
    automated match to d1vk3a1
    complexed with acp, mg, po4

Details for d2hrya1

PDB Entry: 2hry (more details), 2.8 Å

PDB Description: t. maritima purl complexed with amppcp
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrya1:

Sequence, based on SEQRES records: (download)

>d2hrya1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

Sequence, based on observed residues (ATOM records): (download)

>d2hrya1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgvvnlddyysvaf
kiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiadygn
sigvptvggelrisslyahnplvnvlaagvvrndmlvds

SCOPe Domain Coordinates for d2hrya1:

Click to download the PDB-style file with coordinates for d2hrya1.
(The format of our PDB-style files is described here.)

Timeline for d2hrya1: