SCOP 1.73: Domain d2hrya1: 2hry A:2-166

Lineage for d2hrya1 (2hry A:2-166)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (4 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [103083] (6 PDB entries)
   TM1246

8. Domain d2hrya1: 2hry A:2-166 [136704]
   Other proteins in same PDB: d2hrya3, d2hrya4
   automatically matched to d1vk3a1
   complexed with acp, mg, po4; mutant

Details for d2hrya1

PDB Entry: 2hry, 2.8 Å

PDB Description: t. maritima purl complexed with amppcp

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d2hrya1:

Sequence, based on SEQRES records:

>d2hrya1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

Sequence, based on observed residues (ATOM records):

>d2hrya1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgvvnlddyysvaf
kiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiadygn
sigvptvggelrisslyahnplvnvlaagvvrndmlvds

Timeline for d2hrya1:

• d2hrya1 is new in SCOP 1.73
  
• d2hrya1 appears in SCOP 1.75
  
• d2hrya1 appears in the current release, SCOPe 2.08