Lineage for d2hrya3 (2hry A:167-345)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. Protein Phosphoribosylformylglycinamidine synthase II, domain 2 [419052] (1 species)
    protein duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. Species Thermotoga maritima [TaxId:2336] [419543] (7 PDB entries)
    TM1246
  8. Domain d2hrya3: 2hry A:167-345 [136706]
    Other proteins in same PDB: d2hrya1, d2hrya2, d2hrya4
    automated match to d1vk3a3
    complexed with acp, mg, po4

Details for d2hrya3

PDB Entry: 2hry (more details), 2.8 Å

PDB Description: T. maritima PurL complexed with AMPPCP
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrya3:

Sequence, based on SEQRES records: (download)

>d2hrya3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records): (download)

>d2hrya3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgivgdpfaekmlieaflemveeglvegaqdlgaggvlsats
elvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllf
gdvvaevieepvyrvmyrndlvmevpvqllanapeedi

SCOPe Domain Coordinates for d2hrya3 are not available.

Timeline for d2hrya3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hrya1, d2hrya2, d2hrya4