![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
![]() | Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
![]() | Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
![]() | Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries) TM1246 |
![]() | Domain d2hrya2: 2hry A:346-507 [136705] Other proteins in same PDB: d2hrya3, d2hrya4 automated match to d1vk3a2 complexed with acp, mg, po4 |
PDB Entry: 2hry (more details), 2.8 Å
SCOPe Domain Sequences for d2hrya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrya2 d.79.4.1 (A:346-507) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]} veytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvth sradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalkn acefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkv
Timeline for d2hrya2: