Lineage for d2hiaa_ (2hia A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610508Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1610509Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1610510Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1610562Protein automated matches [190196] (7 species)
    not a true protein
  7. 1610620Species Thermus thermophilus HB8 [TaxId:300852] [187129] (15 PDB entries)
  8. 1610623Domain d2hiaa_: 2hia A: [136526]
    automated match to d1v37a_
    complexed with po4

Details for d2hiaa_

PDB Entry: 2hia (more details), 1.6 Å

PDB Description: Crystal structure of TTHB049 from Thermus thermophilus HB8
PDB Compounds: (A:) Alpha-ribazole-5'-phosphate phosphatase

SCOPe Domain Sequences for d2hiaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiaa_ c.60.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrla

SCOPe Domain Coordinates for d2hiaa_:

Click to download the PDB-style file with coordinates for d2hiaa_.
(The format of our PDB-style files is described here.)

Timeline for d2hiaa_: