PDB entry 2hia

View 2hia on RCSB PDB site
Description: Crystal structure of TTHB049 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Thermus thermophilus HB8, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-06-29, released 2006-12-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ribazole-5'-phosphate phosphatase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hiaa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hiaA (A:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlaldgeeatg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hiaA (A:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrla