Lineage for d1v37a_ (1v37 A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the restSuperfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) 
Protein Alpha-ribazole-5'-phosphate phosphatase [117669] (1 species) Species Thermus thermophilus [TaxId:274] [117670] (1 PDB entry)
Uniprot Q53WB3
Domain d1v37a_: 1v37 A: [113497]
complexed with gol
Details for d1v37a_
PDB Entry: 1v37 (more details), 1.4 Å
PDB Description: Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8
PDB Compounds: (A:) phosphoglycerate mutaseSCOPe Domain Sequences for d1v37a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlald
SCOPe Domain Coordinates for d1v37a_:
Click to download the PDB-style file with coordinates for d1v37a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v37a_:
- d1v37a_ first appeared in SCOP 1.71
- d1v37a_ appears in SCOPe 2.03
- d1v37a_ appears in SCOPe 2.05
- d1v37a_ appears in the current release, SCOPe 2.08
View in 3D
