Lineage for d1v37a_ (1v37 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588092Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 588093Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 588094Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)
  6. 588095Protein Alpha-ribazole-5'-phosphate phosphatase [117669] (1 species)
  7. 588096Species Thermus thermophilus [TaxId:274] [117670] (1 PDB entry)
  8. 588097Domain d1v37a_: 1v37 A: [113497]

Details for d1v37a_

PDB Entry: 1v37 (more details), 1.4 Å

PDB Description: Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8

SCOP Domain Sequences for d1v37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlald

SCOP Domain Coordinates for d1v37a_:

Click to download the PDB-style file with coordinates for d1v37a_.
(The format of our PDB-style files is described here.)

Timeline for d1v37a_: