SCOP 1.73: Domain d2hiaa1: 2hia A:1-169

Lineage for d2hiaa1 (2hia A:1-169)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)

6. Protein Alpha-ribazole-5'-phosphate phosphatase [117669] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117670] (2 PDB entries)

8. Domain d2hiaa1: 2hia A:1-169 [136526]
   automatically matched to d1v37a_
   complexed with po4

Details for d2hiaa1

PDB Entry: 2hia, 1.6 Å

PDB Description: Crystal structure of TTHB049 from Thermus thermophilus HB8

PDB Compounds: (A:) Alpha-ribazole-5'-phosphate phosphatase

SCOP Domain Sequences for d2hiaa1:

Sequence; same for both SEQRES and ATOM records:

>d2hiaa1 c.60.1.1 (A:1-169) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrla

Timeline for d2hiaa1:

• d2hiaa1 is new in SCOP 1.73
  
• d2hiaa1 appears in SCOP 1.75
  
• d2hiaa1 appears in the current release, SCOPe 2.08, called d2hiaa_