Lineage for d2hf3a1 (2hf3 A:2-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491727Protein automated matches [226905] (13 species)
    not a true protein
  7. 2491761Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)
  8. 2491762Domain d2hf3a1: 2hf3 A:2-146 [136373]
    automated match to d1d4xa1
    complexed with adp, ca

Details for d2hf3a1

PDB Entry: 2hf3 (more details), 1.8 Å

PDB Description: crystal structure of monomeric actin in the adp bound state
PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d2hf3a1:

Sequence, based on SEQRES records: (download)

>d2hf3a1 c.55.1.1 (A:2-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
deevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d2hf3a1 c.55.1.1 (A:2-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
deevaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypi
ehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpa
myvaiqavlslyasg

SCOPe Domain Coordinates for d2hf3a1:

Click to download the PDB-style file with coordinates for d2hf3a1.
(The format of our PDB-style files is described here.)

Timeline for d2hf3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hf3a2