SCOP 1.73: Domain d2hf3a1: 2hf3 A:2-146

Lineage for d2hf3a1 (2hf3 A:2-146)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (25 PDB entries)

8. Domain d2hf3a1: 2hf3 A:2-146 [136373]
   automatically matched to d1hlua1
   complexed with adp, ca; mutant

Details for d2hf3a1

PDB Entry: 2hf3, 1.8 Å

PDB Description: crystal structure of monomeric actin in the adp bound state

PDB Compounds: (A:) Actin-5C

SCOP Domain Sequences for d2hf3a1:

Sequence, based on SEQRES records:

>d2hf3a1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
deevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d2hf3a1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
deevaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypi
ehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpa
myvaiqavlslyasg

Timeline for d2hf3a1:

• d2hf3a1 is new in SCOP 1.73
  
• d2hf3a1 appears in SCOP 1.75
  
• d2hf3a1 appears in the current release, SCOPe 2.08