SCOPe 2.08: Domain d2hf3a1: 2hf3 A:2-146

Lineage for d2hf3a1 (2hf3 A:2-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)

8. Domain d2hf3a1: 2hf3 A:2-146 [136373]
   automated match to d1d4xa1
   complexed with adp, ca

Details for d2hf3a1

PDB Entry: 2hf3, 1.8 Å

PDB Description: crystal structure of monomeric actin in the adp bound state

PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d2hf3a1:

Sequence, based on SEQRES records:

>d2hf3a1 c.55.1.1 (A:2-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
deevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d2hf3a1 c.55.1.1 (A:2-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
deevaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypi
ehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpa
myvaiqavlslyasg

Timeline for d2hf3a1:

• d2hf3a1 first appeared in SCOP 1.73
  
• d2hf3a1 appears in SCOPe 2.07