Lineage for d1d4xa1 (1d4x A:4-146)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (10 species) 
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [64086] (1 PDB entry) 
Domain d1d4xa1: 1d4x A:4-146 [59107]
Other proteins in same PDB: d1d4xg_
complexed with atp, ca, mg, so2, so4
Details for d1d4xa1
PDB Entry: 1d4x (more details), 1.75 Å
PDB Description: crystal structure of caenorhabditis elegans mg-atp actin complexed with human gelsolin segment 1 at 1.75 a resolution.
PDB Compounds: (A:) c. elegans actin 1/3SCOPe Domain Sequences for d1d4xa1:
Sequence, based on SEQRES records: (download)
>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg
Sequence, based on observed residues (ATOM records): (download)
>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvgqkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg
SCOPe Domain Coordinates for d1d4xa1:
Click to download the PDB-style file with coordinates for d1d4xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d4xa1:
- d1d4xa1 first appeared in SCOP 1.57
- d1d4xa1 appears in SCOPe 2.06
- d1d4xa1 appears in the current release, SCOPe 2.08
View in 3D
