Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Actin [53073] (8 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [64086] (1 PDB entry) |
Domain d1d4xa1: 1d4x A:4-146 [59107] Other proteins in same PDB: d1d4xg_ complexed with atp, ca, mg, so2, so4 |
PDB Entry: 1d4x (more details), 1.75 Å
SCOPe Domain Sequences for d1d4xa1:
Sequence, based on SEQRES records: (download)
>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} evaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim fetfntpamyvaiqavlslyasg
>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} evaalvvdngsgmckagfagddapravfpsivgrprhqgvgqkdsyvgdeaqskrgiltl kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf ntpamyvaiqavlslyasg
Timeline for d1d4xa1: