Lineage for d1d4xa1 (1d4x A:4-146)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. Protein Actin [53073] (10 species)
  7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [64086] (1 PDB entry)
  8. Domain d1d4xa1: 1d4x A:4-146 [59107]
    Other proteins in same PDB: d1d4xg_
    complexed with atp, ca, mg, so2, so4

Details for d1d4xa1

PDB Entry: 1d4x (more details), 1.7500000000000002 Å

PDB Description: crystal structure of caenorhabditis elegans mg-atp actin complexed with human gelsolin segment 1 at 1.75 a resolution.
PDB Compounds: (A:) c. elegans actin 1/3

SCOPe Domain Sequences for d1d4xa1:

Sequence, based on SEQRES records: (download)

>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvgqkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d1d4xa1 are not available.

Timeline for d1d4xa1:

Domains from same chain:
(mouse over for more information)
d1d4xa2
Domains from other chains:
(mouse over for more information)
d1d4xg_