SCOPe 2.08: Domain d2h6jf1: 2h6j F:9-235

Lineage for d2h6jf1 (2h6j F:9-235)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Rhodococcus erythropolis [TaxId:1833] [103314] (3 PDB entries)

8. Domain d2h6jf1: 2h6j F:9-235 [136195]
   Other proteins in same PDB: d2h6jh1, d2h6ji1, d2h6jj1, d2h6jk1, d2h6jl1, d2h6jm1, d2h6jn1
   automatically matched to d1q5qa_

Details for d2h6jf1

PDB Entry: 2h6j, 3.2 Å

PDB Description: crystal structure of the beta f145a rhodococcus proteasome

PDB Compounds: (F:) proteasome alpha-type subunit 1

SCOPe Domain Sequences for d2h6jf1:

Sequence, based on SEQRES records:

>d2h6jf1 d.153.1.4 (F:9-235) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpae

Sequence, based on observed residues (ATOM records):

>d2h6jf1 d.153.1.4 (F:9-235) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggvdvaslevavldqsrprrafrriagtaleqlvpae

Timeline for d2h6jf1:

• d2h6jf1 first appeared in SCOP 1.73
  
• d2h6jf1 appears in SCOPe 2.07