Lineage for d2h6jl1 (2h6j L:-6-219)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993205Species Rhodococcus erythropolis [TaxId:1833] [103313] (3 PDB entries)
  8. 2993224Domain d2h6jl1: 2h6j L:-6-219 [145289]
    Other proteins in same PDB: d2h6ja1, d2h6jb1, d2h6jc1, d2h6jd1, d2h6je1, d2h6jf1, d2h6jg1
    automatically matched to 2H6J H:-6-219

Details for d2h6jl1

PDB Entry: 2h6j (more details), 3.2 Å

PDB Description: crystal structure of the beta f145a rhodococcus proteasome
PDB Compounds: (L:) proteasome beta-type subunit 1

SCOPe Domain Sequences for d2h6jl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6jl1 d.153.1.4 (L:-6-219) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
dlaphgttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaie
lvrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldadde
sragrivsydvvggryeeragyhavgsgslaaksalkkiyspdsdeetalraaieslyda
adddsatggpdltrgiyptavtitqagavhvseettselarriva

SCOPe Domain Coordinates for d2h6jl1:

Click to download the PDB-style file with coordinates for d2h6jl1.
(The format of our PDB-style files is described here.)

Timeline for d2h6jl1: