SCOP 1.73: Domain d2h5lg1: 2h5l G:190-352

Lineage for d2h5lg1 (2h5l G:190-352)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein S-adenosylhomocystein hydrolase [51845] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries)

8. Domain d2h5lg1: 2h5l G:190-352 [136163]
   Other proteins in same PDB: d2h5la2, d2h5lb2, d2h5lc2, d2h5ld2, d2h5le2, d2h5lf2, d2h5lg2, d2h5lh2
   automatically matched to d1d4fa1
   complexed with 3dd, nad

Details for d2h5lg1

PDB Entry: 2h5l, 2.8 Å

PDB Description: s-adenosylhomocysteine hydrolase containing nad and 3-deaza-d- eritadenine

PDB Compounds: (G:) Adenosylhomocysteinase

SCOP Domain Sequences for d2h5lg1:

Sequence; same for both SEQRES and ATOM records:

>d2h5lg1 c.2.1.4 (G:190-352) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus) [TaxId: 10116]}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

Timeline for d2h5lg1:

• d2h5lg1 is new in SCOP 1.73
  
• d2h5lg1 appears in SCOP 1.75
  
• d2h5lg1 appears in the current release, SCOPe 2.08