![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein) |
![]() | Protein S-adenosylhomocystein hydrolase [52301] (3 species) contains additional secondary structures disguising the superfamily fold |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries) |
![]() | Domain d2h5ld2: 2h5l D:2-189,D:353-431 [136158] Other proteins in same PDB: d2h5la1, d2h5lb1, d2h5lc1, d2h5ld1, d2h5le1, d2h5lf1, d2h5lg1, d2h5lh1 automatically matched to d1d4fa2 complexed with 3dd, nad |
PDB Entry: 2h5l (more details), 2.8 Å
SCOP Domain Sequences for d2h5ld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5ld2 c.23.12.3 (D:2-189,D:353-431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus) [TaxId: 10116]} dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv kltkltekqaqylgmpingpfkpdhyry
Timeline for d2h5ld2: