Lineage for d2h5lc2 (2h5l C:2-189,C:353-431)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692394Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 692501Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 692502Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 692512Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
  8. 692543Domain d2h5lc2: 2h5l C:2-189,C:353-431 [136156]
    Other proteins in same PDB: d2h5la1, d2h5lb1, d2h5lc1, d2h5ld1, d2h5le1, d2h5lf1, d2h5lg1, d2h5lh1
    automatically matched to d1d4fa2
    complexed with 3dd, nad

Details for d2h5lc2

PDB Entry: 2h5l (more details), 2.8 Å

PDB Description: s-adenosylhomocysteine hydrolase containing nad and 3-deaza-d- eritadenine
PDB Compounds: (C:) Adenosylhomocysteinase

SCOP Domain Sequences for d2h5lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5lc2 c.23.12.3 (C:2-189,C:353-431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOP Domain Coordinates for d2h5lc2:

Click to download the PDB-style file with coordinates for d2h5lc2.
(The format of our PDB-style files is described here.)

Timeline for d2h5lc2: