SCOP 1.73: Domain d2h5lh2: 2h5l H:2-189,H:353-431

Lineage for d2h5lh2 (2h5l H:2-189,H:353-431)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)

6. Protein S-adenosylhomocystein hydrolase [52301] (3 species)
   contains additional secondary structures disguising the superfamily fold

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)

8. Domain d2h5lh2: 2h5l H:2-189,H:353-431 [136166]
   Other proteins in same PDB: d2h5la1, d2h5lb1, d2h5lc1, d2h5ld1, d2h5le1, d2h5lf1, d2h5lg1, d2h5lh1
   automatically matched to d1d4fa2
   complexed with 3dd, nad

Details for d2h5lh2

PDB Entry: 2h5l, 2.8 Å

PDB Description: s-adenosylhomocysteine hydrolase containing nad and 3-deaza-d- eritadenine

PDB Compounds: (H:) Adenosylhomocysteinase

SCOP Domain Sequences for d2h5lh2:

Sequence; same for both SEQRES and ATOM records:

>d2h5lh2 c.23.12.3 (H:2-189,H:353-431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

Timeline for d2h5lh2:

• d2h5lh2 is new in SCOP 1.73
  
• d2h5lh2 appears in SCOP 1.75
  
• d2h5lh2 appears in the current release, SCOPe 2.08