SCOPe 2.08: Domain d2h27a1: 2h27 A:122-190

Lineage for d2h27a1 (2h27 A:122-190)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.2: Sigma4 domain [88665] (5 proteins)

6. Protein SigmaE factor (RpoE) [88993] (1 species)

7. Species Escherichia coli [TaxId:562] [88994] (2 PDB entries)

8. Domain d2h27a1: 2h27 A:122-190 [135993]
   Other proteins in same PDB: d2h27a2
   automatically matched to d1or7b1
   protein/DNA complex; complexed with mpd

Details for d2h27a1

PDB Entry: 2h27, 2.3 Å

PDB Description: crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna

PDB Compounds: (A:) RNA polymerase Sigma E factor

SCOPe Domain Sequences for d2h27a1:

Sequence; same for both SEQRES and ATOM records:

>d2h27a1 a.4.13.2 (A:122-190) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]}
mlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrareai
dnkvqplir

Timeline for d2h27a1:

• d2h27a1 first appeared in SCOP 1.73
  
• d2h27a1 appears in SCOPe 2.07