PDB entry 2h27

View 2h27 on RCSB PDB site
Description: Crystal Structure of Escherichia coli SigmaE Region 4 Bound to its-35 Element DNA
Class: transferase/DNA
Keywords: Protein-DNA Complex, Helix-Turn-Helix, Double Helix, transferase-DNA COMPLEX
Deposited on 2006-05-18, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase Sigma E factor
    Species: Escherichia coli [TaxId:83333]
    Gene: rpoE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGB6 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.08: d2h27a1, d2h27a2
  • Chain 'B':
    Compound: 5'-d(*cp*cp*cp*gp*gp*ap*ap*cp*tp*tp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*c*cp*gp*ap*ap*gp*tp*tp*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: RNA polymerase Sigma E factor
    Species: Escherichia coli [TaxId:83333]
    Gene: rpoE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h27d1
  • Chain 'E':
    Compound: 5'-d(*cp*cp*cp*gp*gp*ap*ap*cp*tp*tp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(*c*cp*gp*ap*ap*gp*tp*tp*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h27A (A:)
    gshmlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrar
    eaidnkvqplirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h27A (A:)
    shmlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrare
    aidnkvqplir
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h27D (D:)
    gshmlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrar
    eaidnkvqplirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h27D (D:)
    mlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrareai
    dnkvqplir
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.