Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species) duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3 |
Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries) |
Domain d2gysa4: 2gys A:317-418 [135868] automated match to d1gh7a4 |
PDB Entry: 2gys (more details), 2.7 Å
SCOPe Domain Sequences for d2gysa4:
Sequence, based on SEQRES records: (download)
>d2gysa4 b.1.2.1 (A:317-418) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna hsmalpalepstrywarvrvrtsrtgyngiwsewsearswdt
>d2gysa4 b.1.2.1 (A:317-418) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} svniqmappslqvtdsyslrwetdhtfeiqyrkdtatwkdsktetlqnahsmalpaleps trywarvrvrtsrtgyngiwsewsearswdt
Timeline for d2gysa4:
View in 3D Domains from other chains: (mouse over for more information) d2gysb1, d2gysb2, d2gysb3, d2gysb4 |