Lineage for d2gysa4 (2gys A:317-418)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371700Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 2371701Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries)
  8. 2371705Domain d2gysa4: 2gys A:317-418 [135868]
    automated match to d1gh7a4

Details for d2gysa4

PDB Entry: 2gys (more details), 2.7 Å

PDB Description: 2.7 a structure of the extracellular domains of the human beta common receptor involved in il-3, il-5, and gm-csf signalling
PDB Compounds: (A:) cytokine receptor common beta chain

SCOPe Domain Sequences for d2gysa4:

Sequence, based on SEQRES records: (download)

>d2gysa4 b.1.2.1 (A:317-418) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna
hsmalpalepstrywarvrvrtsrtgyngiwsewsearswdt

Sequence, based on observed residues (ATOM records): (download)

>d2gysa4 b.1.2.1 (A:317-418) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
svniqmappslqvtdsyslrwetdhtfeiqyrkdtatwkdsktetlqnahsmalpaleps
trywarvrvrtsrtgyngiwsewsearswdt

SCOPe Domain Coordinates for d2gysa4:

Click to download the PDB-style file with coordinates for d2gysa4.
(The format of our PDB-style files is described here.)

Timeline for d2gysa4: