Lineage for d2gysa3 (2gys A:218-316)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries)
  8. Domain d2gysa3: 2gys A:218-316 [135867]
    automated match to d1gh7a3

Details for d2gysa3

PDB Entry: 2gys (more details), 2.7 Å

PDB Description: 2.7 a structure of the extracellular domains of the human beta common receptor involved in il-3, il-5, and gm-csf signalling
PDB Compounds: (A:) cytokine receptor common beta chain

SCOPe Domain Sequences for d2gysa3:

Sequence, based on SEQRES records: (download)

>d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
eaqpqnlecffdgaavlscswevrkevassvsfglfykpspdagsavllreeecspvlre
glgslhtrhhcqipvpdpathgqyivsvqprraekhiks

Sequence, based on observed residues (ATOM records): (download)

>d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
eaqpqnlecffdgaavlscswevrkevassvsfglfykpsavllreeecspvlreglgsl
htrhhcqipvpdpathgqyivsvqprraekhiks

SCOPe Domain Coordinates for d2gysa3 are not available.

Timeline for d2gysa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gysa1, d2gysa2, d2gysa4
View in 3D
Domains from other chains:
(mouse over for more information)
d2gysb1, d2gysb2, d2gysb3, d2gysb4