![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
![]() | Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species) duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries) |
![]() | Domain d2gysa4: 2gys A:317-416 [135868] automatically matched to d1gh7a4 complexed with bma, fuc, nag, ndg; mutant |
PDB Entry: 2gys (more details), 2.7 Å
SCOP Domain Sequences for d2gysa4:
Sequence, based on SEQRES records: (download)
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna hsmalpalepstrywarvrvrtsrtgyngiwsewsearsw
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} svniqmappslqvtdsyslrwetdhtfeiqyrkdtatwkdsktetlqnahsmalpaleps trywarvrvrtsrtgyngiwsewsearsw
Timeline for d2gysa4:
![]() Domains from other chains: (mouse over for more information) d2gysb1, d2gysb2, d2gysb3, d2gysb4 |