Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.6: ETF-QO domain-like [143256] (1 protein) Pfam PF05187; Electron transfer flavoprotein-ubiquinone oxidoreductase; contains single Fe4-S4 cluster |
Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [143257] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [143258] (2 PDB entries) Uniprot P55931 506-607 |
Domain d2gmja3: 2gmj A:483-584 [135385] Other proteins in same PDB: d2gmja1, d2gmja2, d2gmjb1, d2gmjb2 automated match to d2gmha3 complexed with fad, sf4, tbu |
PDB Entry: 2gmj (more details), 2.6 Å
SCOPe Domain Sequences for d2gmja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmja3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} fdllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleqgd gfrlqinaqncvhcktcdikdpsqninwvvpeggggpayngm
Timeline for d2gmja3: