![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.8: Electron transfer flavoprotein-ubiquinone oxidoreductase-like [142988] (1 protein) |
![]() | Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [142989] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [142990] (2 PDB entries) Uniprot P55931 260-358 |
![]() | Domain d2gmjb2: 2gmj B:237-335 [135387] Other proteins in same PDB: d2gmja1, d2gmja3, d2gmjb1, d2gmjb3 automated match to d2gmha2 complexed with fad, sf4, tbu |
PDB Entry: 2gmj (more details), 2.6 Å
SCOPe Domain Sequences for d2gmjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmjb2 d.16.1.8 (B:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} tygiglkelwvidekkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldy qnpylspfrefqrwkhhpsikptleggkriaygaralne
Timeline for d2gmjb2: