Lineage for d2gmjb3 (2gmj B:483-584)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949450Family d.58.1.6: ETF-QO domain-like [143256] (1 protein)
    Pfam PF05187; Electron transfer flavoprotein-ubiquinone oxidoreductase; contains single Fe4-S4 cluster
  6. 2949451Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [143257] (1 species)
  7. 2949452Species Pig (Sus scrofa) [TaxId:9823] [143258] (2 PDB entries)
    Uniprot P55931 506-607
  8. 2949456Domain d2gmjb3: 2gmj B:483-584 [135388]
    Other proteins in same PDB: d2gmja1, d2gmja2, d2gmjb1, d2gmjb2
    automated match to d2gmha3
    complexed with fad, sf4, tbu

Details for d2gmjb3

PDB Entry: 2gmj (more details), 2.6 Å

PDB Description: Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase
PDB Compounds: (B:) Electron transfer flavoprotein-ubiquinone oxidoreductase

SCOPe Domain Sequences for d2gmjb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmjb3 d.58.1.6 (B:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
fdllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleqgd
gfrlqinaqncvhcktcdikdpsqninwvvpeggggpayngm

SCOPe Domain Coordinates for d2gmjb3:

Click to download the PDB-style file with coordinates for d2gmjb3.
(The format of our PDB-style files is described here.)

Timeline for d2gmjb3: