Lineage for d2gmjb1 (2gmj B:7-236,B:336-482)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849406Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [141940] (1 species)
  7. 2849407Species Pig (Sus scrofa) [TaxId:9823] [141941] (2 PDB entries)
    Uniprot P55931 27-259,359-505
  8. 2849411Domain d2gmjb1: 2gmj B:7-236,B:336-482 [135386]
    Other proteins in same PDB: d2gmja2, d2gmja3, d2gmjb2, d2gmjb3
    automated match to d2gmha1
    complexed with fad, sf4, tbu

Details for d2gmjb1

PDB Entry: 2gmj (more details), 2.6 Å

PDB Description: Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase
PDB Compounds: (B:) Electron transfer flavoprotein-ubiquinone oxidoreductase

SCOPe Domain Sequences for d2gmjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmjb1 c.3.1.2 (B:7-236,B:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
pritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaqhekdlr
vclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltekyripvp
ilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkgiatndv
giqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqXggfqsipkl
tfpgglligcspgfmnvpkikgthtamksgtlaaesifnqltsenlqsktiglhvteyed
nlknswvwkelysvrnirpschgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlk
pakdctpieypkpdgqis

SCOPe Domain Coordinates for d2gmjb1:

Click to download the PDB-style file with coordinates for d2gmjb1.
(The format of our PDB-style files is described here.)

Timeline for d2gmjb1: