PDB entry 2gmj

View 2gmj on RCSB PDB site
Description: Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase
Class: oxidoreductase
Keywords: Electron Transfer, Flavoprotein, Oxidoreductase, Ubiquinone
Deposited on 2006-04-06, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Electron transfer flavoprotein-ubiquinone oxidoreductase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gmja1, d2gmja2, d2gmja3
  • Chain 'B':
    Compound: Electron transfer flavoprotein-ubiquinone oxidoreductase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gmjb1, d2gmjb2, d2gmjb3
  • Heterogens: SF4, FAD, TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gmjA (A:)
    sstckvpritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaq
    hekdlrvclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltek
    yripvpilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkg
    iatndvgiqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqtygi
    glkelwvidekkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldyqnpy
    lspfrefqrwkhhpsikptleggkriaygaralneggfqsipkltfpgglligcspgfmn
    vpkikgthtamksgtlaaesifnqltsenlqsktiglhvteyednlknswvwkelysvrn
    irpschgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlkpakdctpieypkpdgq
    isfdllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleq
    gdgfrlqinaqncvhcktcdikdpsqninwvvpeggggpayngm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmjA (A:)
    ckvpritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaqhek
    dlrvclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltekyri
    pvpilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkgiat
    ndvgiqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqtygiglk
    elwvidekkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldyqnpylsp
    frefqrwkhhpsikptleggkriaygaralneggfqsipkltfpgglligcspgfmnvpk
    ikgthtamksgtlaaesifnqltsenlqsktiglhvteyednlknswvwkelysvrnirp
    schgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlkpakdctpieypkpdgqisf
    dllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleqgdg
    frlqinaqncvhcktcdikdpsqninwvvpeggggpayngm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gmjB (B:)
    sstckvpritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaq
    hekdlrvclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltek
    yripvpilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkg
    iatndvgiqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqtygi
    glkelwvidekkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldyqnpy
    lspfrefqrwkhhpsikptleggkriaygaralneggfqsipkltfpgglligcspgfmn
    vpkikgthtamksgtlaaesifnqltsenlqsktiglhvteyednlknswvwkelysvrn
    irpschgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlkpakdctpieypkpdgq
    isfdllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleq
    gdgfrlqinaqncvhcktcdikdpsqninwvvpeggggpayngm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmjB (B:)
    pritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaqhekdlr
    vclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltekyripvp
    ilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkgiatndv
    giqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqtygiglkelw
    videkkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldyqnpylspfre
    fqrwkhhpsikptleggkriaygaralneggfqsipkltfpgglligcspgfmnvpkikg
    thtamksgtlaaesifnqltsenlqsktiglhvteyednlknswvwkelysvrnirpsch
    gilgvyggmiytgifywifrgmepwtlkhkgsdsdqlkpakdctpieypkpdgqisfdll
    ssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleqgdgfrl
    qinaqncvhcktcdikdpsqninwvvpeggggpayngm