Class b: All beta proteins [48724] (165 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) |
Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein) less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain |
Protein Methylamine dehydrogenase, H-chain [50971] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [50972] (10 PDB entries) |
Domain d2gc4m1: 2gc4 M:32-386 [134946] Other proteins in same PDB: d2gc4b1, d2gc4c1, d2gc4d1, d2gc4f1, d2gc4g1, d2gc4h1, d2gc4j1, d2gc4k1, d2gc4l1, d2gc4n1, d2gc4o1, d2gc4p1 automatically matched to d2bbkh_ complexed with cu, hem, na, trq |
PDB Entry: 2gc4 (more details), 1.9 Å
SCOP Domain Sequences for d2gc4m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc4m1 b.69.2.1 (M:32-386) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg
Timeline for d2gc4m1: