![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
![]() | Protein Cytochrome c551 [46660] (4 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries) |
![]() | Domain d2gc4p1: 2gc4 P:1-147 [134949] Other proteins in same PDB: d2gc4a1, d2gc4b1, d2gc4c1, d2gc4e1, d2gc4f1, d2gc4g1, d2gc4i1, d2gc4j1, d2gc4k1, d2gc4m1, d2gc4n1, d2gc4o1 automatically matched to d1mg2d_ complexed with cu, hem, na, trq |
PDB Entry: 2gc4 (more details), 1.9 Å
SCOP Domain Sequences for d2gc4p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc4p1 a.3.1.1 (P:1-147) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]} apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv rhlytgdpkdaswltdeqkagftpfqp
Timeline for d2gc4p1: