Lineage for d2gc4k1 (2gc4 K:1-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660501Protein Amicyanin [49505] (2 species)
  7. 660502Species Paracoccus denitrificans [TaxId:266] [49506] (19 PDB entries)
  8. 660532Domain d2gc4k1: 2gc4 K:1-105 [134944]
    Other proteins in same PDB: d2gc4a1, d2gc4b1, d2gc4d1, d2gc4e1, d2gc4f1, d2gc4h1, d2gc4i1, d2gc4j1, d2gc4l1, d2gc4m1, d2gc4n1, d2gc4p1
    automatically matched to d1aac__
    complexed with cu, hem, na, trq

Details for d2gc4k1

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (K:) amicyanin

SCOP Domain Sequences for d2gc4k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4k1 b.6.1.1 (K:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOP Domain Coordinates for d2gc4k1:

Click to download the PDB-style file with coordinates for d2gc4k1.
(The format of our PDB-style files is described here.)

Timeline for d2gc4k1: