Lineage for d2gc4f1 (2gc4 F:7-131)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749562Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 749563Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) (S)
  5. 749564Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)
  6. 749565Protein Methylamine dehydrogenase [57563] (2 species)
  7. 749570Species Paracoccus denitrificans [TaxId:266] [57564] (7 PDB entries)
  8. 749578Domain d2gc4f1: 2gc4 F:7-131 [134939]
    Other proteins in same PDB: d2gc4a1, d2gc4c1, d2gc4d1, d2gc4e1, d2gc4g1, d2gc4h1, d2gc4i1, d2gc4k1, d2gc4l1, d2gc4m1, d2gc4o1, d2gc4p1
    automatically matched to d1mg2b_
    complexed with cu, hem, na, trq

Details for d2gc4f1

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (F:) Methylamine dehydrogenase light chain

SCOP Domain Sequences for d2gc4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4f1 g.21.1.1 (F:7-131) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOP Domain Coordinates for d2gc4f1:

Click to download the PDB-style file with coordinates for d2gc4f1.
(The format of our PDB-style files is described here.)

Timeline for d2gc4f1: