Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain [64349] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [143638] (1 PDB entry) Uniprot Q9UHN1 66-355 |
Domain d2g4cc2: 2g4c C:67-355 [134587] Other proteins in same PDB: d2g4ca1, d2g4cb1, d2g4cc1, d2g4cd1 automated match to d1g5hd2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2g4c (more details), 3.15 Å
SCOPe Domain Sequences for d2g4cc2:
Sequence, based on SEQRES records: (download)
>d2g4cc2 d.104.1.1 (C:67-355) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqvf pvdalhhkpgpllpgdsafrlvsaetlreilqdkelskeqlvtflenvlktsgklrenll hgalehyvncldlvnkrlpyglaqigvcfhpvfdtkqirngvksigekteaslvwftppr tsnqwldfwlrhrlqwwrkfamspsnfsssdcqdeegrkgnklyynfpwgkelietlwnl gdhellhmypgnvsklhgrdgrknvvpcvlsvngdldrgmlaylydsfq
>d2g4cc2 d.104.1.1 (C:67-355) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqvf pvdalhhkpgpllpgdsafrlvsaetlreilqdkelskeqlvtflenvlktsgklrenll hgalehyvncldlvnkrlpyglaqigvcfhpvksigekteaslvwftpprtsnqwldfwl rhrlqwwrkfamspsnfsssdcqdeegrkgnklyynfpwgkelietlwnlgdhellhmyp gnvsklhgrdgrknvvpcvlsvngdldrgmlaylydsfq
Timeline for d2g4cc2: