Lineage for d2g4ca2 (2g4c A:66-355)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532558Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2532745Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain [64349] (2 species)
  7. 2532746Species Human (Homo sapiens) [TaxId:9606] [143638] (1 PDB entry)
    Uniprot Q9UHN1 66-355
  8. 2532747Domain d2g4ca2: 2g4c A:66-355 [134583]
    Other proteins in same PDB: d2g4ca1, d2g4cb1, d2g4cc1, d2g4cd1

Details for d2g4ca2

PDB Entry: 2g4c (more details), 3.15 Å

PDB Description: crystal structure of human dna polymerase gamma accessory subunit
PDB Compounds: (A:) DNA polymerase gamma subunit 2

SCOPe Domain Sequences for d2g4ca2:

Sequence, based on SEQRES records: (download)

>d2g4ca2 d.104.1.1 (A:66-355) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqv
fpvdalhhkpgpllpgdsafrlvsaetlreilqdkelskeqlvtflenvlktsgklrenl
lhgalehyvncldlvnkrlpyglaqigvcfhpvfdtkqirngvksigekteaslvwftpp
rtsnqwldfwlrhrlqwwrkfamspsnfsssdcqdeegrkgnklyynfpwgkelietlwn
lgdhellhmypgnvsklhgrdgrknvvpcvlsvngdldrgmlaylydsfq

Sequence, based on observed residues (ATOM records): (download)

>d2g4ca2 d.104.1.1 (A:66-355) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqv
fpvdalhhkpgpllpgdsafrlvsaetlreilqdkelskeqlvtflenvlktsgklrenl
lhgalehyvncldlvnkrlpyglaqigvcfhpvksigekteaslvwftpprtsnqwldfw
lrhrlqwwrkfamspsnfsssdcqdeegrkgnklyynfpwgkelietlwnlgdhellhmy
pgnvsklhgrdgrknvvpcvlsvngdldrgmlaylydsfq

SCOPe Domain Coordinates for d2g4ca2:

Click to download the PDB-style file with coordinates for d2g4ca2.
(The format of our PDB-style files is described here.)

Timeline for d2g4ca2: