Lineage for d2g4cd1 (2g4c D:368-485)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2881871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2881872Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2881942Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)
  7. 2881943Species Human (Homo sapiens) [TaxId:9606] [142419] (2 PDB entries)
    Uniprot Q9UHN1 369-485
  8. 2881947Domain d2g4cd1: 2g4c D:368-485 [134588]
    Other proteins in same PDB: d2g4ca2, d2g4cb2, d2g4cc2, d2g4cd2
    automated match to d1g5hd1

Details for d2g4cd1

PDB Entry: 2g4c (more details), 3.15 Å

PDB Description: crystal structure of human dna polymerase gamma accessory subunit
PDB Compounds: (D:) DNA polymerase gamma subunit 2

SCOPe Domain Sequences for d2g4cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4cd1 c.51.1.1 (D:368-485) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hrkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletmqssleq
lyskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyissaknv

SCOPe Domain Coordinates for d2g4cd1:

Click to download the PDB-style file with coordinates for d2g4cd1.
(The format of our PDB-style files is described here.)

Timeline for d2g4cd1: