SCOPe 2.08: Domain d2g4cc1: 2g4c C:368-485

Lineage for d2g4cc1 (2g4c C:368-485)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142419] (2 PDB entries)
   Uniprot Q9UHN1 369-485

8. Domain d2g4cc1: 2g4c C:368-485 [134586]
   Other proteins in same PDB: d2g4ca2, d2g4cb2, d2g4cc2, d2g4cd2
   automated match to d1g5hd1

Details for d2g4cc1

PDB Entry: 2g4c, 3.15 Å

PDB Description: crystal structure of human dna polymerase gamma accessory subunit

PDB Compounds: (C:) DNA polymerase gamma subunit 2

SCOPe Domain Sequences for d2g4cc1:

Sequence; same for both SEQRES and ATOM records:

>d2g4cc1 c.51.1.1 (C:368-485) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hrkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletmqssleq
lyskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyissaknv

Timeline for d2g4cc1:

• d2g4cc1 first appeared in SCOP 1.73
  
• d2g4cc1 appears in SCOPe 2.07