![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52627] (11 PDB entries) Uniprot P02990 |
![]() | Domain d2fx3a3: 2fx3 A:9-204 [134273] Other proteins in same PDB: d2fx3a1, d2fx3a2 automatically matched to d1ob2a3 complexed with gdp, mg |
PDB Entry: 2fx3 (more details), 3.4 Å
SCOPe Domain Sequences for d2fx3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx3a3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
Timeline for d2fx3a3: