Lineage for d2fx3a2 (2fx3 A:297-392)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793894Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 2793901Species Escherichia coli [TaxId:562] [50468] (9 PDB entries)
    Uniprot P02990
  8. 2793914Domain d2fx3a2: 2fx3 A:297-392 [134272]
    Other proteins in same PDB: d2fx3a1, d2fx3a3
    automatically matched to d1d8ta2
    complexed with gdp, mg

Details for d2fx3a2

PDB Entry: 2fx3 (more details), 3.4 Å

PDB Description: Crystal Structure Determination of E. coli Elongation Factor, Tu using a Twinned Data Set
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d2fx3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx3a2 b.44.1.1 (A:297-392) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvl

SCOPe Domain Coordinates for d2fx3a2:

Click to download the PDB-style file with coordinates for d2fx3a2.
(The format of our PDB-style files is described here.)

Timeline for d2fx3a2: