Lineage for d2fuha_ (2fuh A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. Protein automated matches [190124] (13 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186848] (51 PDB entries)
  8. Domain d2fuha_: 2fuh A: [134173]
    Other proteins in same PDB: d2fuhb_
    automated match to d3rpga_

Details for d2fuha_

PDB Entry: 2fuh (more details)

PDB Description: Solution Structure of the UbcH5c/Ub Non-covalent Complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d2fuha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuha_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d2fuha_ are not available.

Timeline for d2fuha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fuhb_