SCOPe 2.07: Domain d2fuha_: 2fuh A:

Lineage for d2fuha_ (2fuh A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)

8. Domain d2fuha_: 2fuh A: [134173]
   Other proteins in same PDB: d2fuhb_
   automated match to d3rpga_

Details for d2fuha_

PDB Entry: 2fuh

PDB Description: solution structure of the ubch5c/ub non-covalent complex

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d2fuha_:

Sequence; same for both SEQRES and ATOM records:

>d2fuha_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

Timeline for d2fuha_:

• d2fuha_ first appeared in SCOP 1.73, called d2fuha1
  
• d2fuha_ appears in SCOPe 2.06
  
• d2fuha_ appears in the current release, SCOPe 2.08