SCOPe 2.08: Domain d2fu5d_: 2fu5 D:

Lineage for d2fu5d_ (2fu5 D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab8a [142293] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142294] (1 PDB entry)
   Uniprot P55258 3-175

8. Domain d2fu5d_: 2fu5 D: [134105]
   Other proteins in same PDB: d2fu5a1, d2fu5a2, d2fu5b2, d2fu5b3
   automated match to d2fu5c1
   complexed with bme, zn

Details for d2fu5d_

PDB Entry: 2fu5, 2 Å

PDB Description: structure of rab8 in complex with mss4

PDB Compounds: (D:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d2fu5d_:

Sequence, based on SEQRES records:

>d2fu5d_ c.37.1.8 (D:) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}
ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdknwk

Sequence, based on observed residues (ATOM records):

>d2fu5d_ c.37.1.8 (D:) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}
ktydylfkllligdsafnstfistigidfkirtieldgkriklqiwdtagqerfrtitta
yyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkdvdkrqvskergek
laldygikfmetaninvenafftlardikakmdknwk

Timeline for d2fu5d_:

• d2fu5d_ first appeared in SCOP 1.73, called d2fu5d1
  
• d2fu5d_ appears in SCOPe 2.07