SCOPe 2.08: Domain d2fn3a1: 2fn3 A:182-341

Lineage for d2fn3a1 (2fn3 A:182-341)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Benzoylformate decarboxylase [52482] (1 species)

7. Species Pseudomonas putida [TaxId:303] [52483] (43 PDB entries)
   Uniprot P20906

8. Domain d2fn3a1: 2fn3 A:182-341 [133803]
   Other proteins in same PDB: d2fn3a2, d2fn3a3
   automated match to d1q6za1
   complexed with ca, mg, tzd; mutant

Details for d2fn3a1

PDB Entry: 2fn3, 1 Å

PDB Description: high resolution structure of s26a mutant of benzoylformate decarboxylase from pseudomonas putida complexed with thiamine thiazolone diphosphate

PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d2fn3a1:

Sequence; same for both SEQRES and ATOM records:

>d2fn3a1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

Timeline for d2fn3a1:

• d2fn3a1 first appeared in SCOP 1.73
  
• d2fn3a1 appears in SCOPe 2.07