Lineage for d2fn3a3 (2fn3 A:342-525)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865433Species Pseudomonas putida [TaxId:303] [254984] (38 PDB entries)
  8. 2865435Domain d2fn3a3: 2fn3 A:342-525 [133805]
    Other proteins in same PDB: d2fn3a1
    automated match to d1q6za3
    complexed with ca, mg, tzd; mutant

Details for d2fn3a3

PDB Entry: 2fn3 (more details), 1 Å

PDB Description: high resolution structure of s26a mutant of benzoylformate decarboxylase from pseudomonas putida complexed with thiamine thiazolone diphosphate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d2fn3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn3a3 c.36.1.0 (A:342-525) automated matches {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

SCOPe Domain Coordinates for d2fn3a3:

Click to download the PDB-style file with coordinates for d2fn3a3.
(The format of our PDB-style files is described here.)

Timeline for d2fn3a3: